Recombinant Full Length Brucella Suis Upf0283 Membrane Protein Bsuis_A1077 (Bsuis_A1077) Protein, His-Tagged
Cat.No. : | RFL20331BF |
Product Overview : | Recombinant Full Length Brucella suis UPF0283 membrane protein BSUIS_A1077 (BSUIS_A1077) Protein (B0CGI5) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MSDKTPRKPTAFRLEQPARVSAASEQEEPRHPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISTRALVDIGY VIFESARLIRRLSQLYGGRPGTLGFIKLARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGELARLNSDRNARK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BSUIS_A1077 |
Synonyms | BSUIS_A1077; UPF0283 membrane protein BSUIS_A1077 |
UniProt ID | B0CGI5 |
◆ Recombinant Proteins | ||
HBEGF-3493HF | Recombinant Full Length Human HBEGF Protein, GST-tagged | +Inquiry |
C10orf113-1285H | Recombinant Human C10orf113 Protein, His-tagged | +Inquiry |
RFL11303SF | Recombinant Full Length Saccharomyces Cerevisiae Plasma Membrane Fusion Protein Prm1(Prm1) Protein, His-Tagged | +Inquiry |
LEPR-515H | Recombinant Human LEPR protein, His-tagged | +Inquiry |
IL7-14210H | Recombinant Human IL7, His-tagged | +Inquiry |
◆ Native Proteins | ||
COL2A1-16C | Native Chicken COL2A1 Protein | +Inquiry |
NEFL-181B | Native bovine NEFL | +Inquiry |
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPGS2-8223HCL | Recombinant Human C18orf10 293 Cell Lysate | +Inquiry |
Kidney-263R | Rhesus monkey Kidney Lysate | +Inquiry |
LILRB3-1653MCL | Recombinant Mouse LILRB3 cell lysate | +Inquiry |
RGS18-2381HCL | Recombinant Human RGS18 293 Cell Lysate | +Inquiry |
MAP6-401HCL | Recombinant Human MAP6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BSUIS_A1077 Products
Required fields are marked with *
My Review for All BSUIS_A1077 Products
Required fields are marked with *
0
Inquiry Basket