Recombinant Full Length Brassica Napus Omega-3 Fatty Acid Desaturase, Endoplasmic Reticulum(Fad3) Protein, His-Tagged
Cat.No. : | RFL25620BF |
Product Overview : | Recombinant Full Length Brassica napus Omega-3 fatty acid desaturase, endoplasmic reticulum(FAD3) Protein (P48624) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brassica napus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-383) |
Form : | Lyophilized powder |
AA Sequence : | MVVAMDQRSNVNGDSGARKEEGFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSYVTRDI FAVAALAMAAVYFDSWFLWPLYWVAQGTLFWAIFVLGHDCGHGSFSDIPLLNSVVGHILH SFILVPYHGWRISHRTHHQNHGHVENDESWVPLPEKLYKNLPHSTRMLRYTVPLPMLAYP IYLWYRSPGKEGSHFNPYSSLFAPSERKLIATSTTCWSIMLATLVYLSFLVDPVTVLKVY GVPYIIFVMWLDAVTYLHHHGHDEKLPWYRGKEWSYLRGGLTTIDRDYGIFNNIHHDIGT HVIHHLFPQIPHYHLVDATRAAKHVLGRYYREPKTSGAIPIHLVESLVASIKKDHYVSDT GDIVFYETDPDLYVYASDKSKIN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAD3 |
Synonyms | FAD3; BnaC04g14820D; GSBRNA2T00113350001; Acyl-lipid omega-3 desaturase; cytochrome b5, endoplasmic reticulum; Omega-3 fatty acid desaturase 3, endoplasmic reticulum |
UniProt ID | P48624 |
◆ Recombinant Proteins | ||
RFL23494MF | Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg452 Homolog (Mpn_666) Protein, His-Tagged | +Inquiry |
OSM-321O | Active Recombinant Human OSM Protein (228 aa) | +Inquiry |
UCMA-1700HF | Recombinant Full Length Human UCMA Protein, GST-tagged | +Inquiry |
ACBP-3046H | Recombinant Human ACBP, His-tagged | +Inquiry |
SEPT9-4987R | Recombinant Rat SEPT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1803L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 594 labeled | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
HP-193S | Native Swine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIFC3-934HCL | Recombinant Human KIFC3 cell lysate | +Inquiry |
ENO2-6598HCL | Recombinant Human ENO2 293 Cell Lysate | +Inquiry |
RDH5-2435HCL | Recombinant Human RDH5 293 Cell Lysate | +Inquiry |
Kidney-26H | Human Kidney Tissue Lysate | +Inquiry |
PALLD-469HCL | Recombinant Human PALLD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAD3 Products
Required fields are marked with *
My Review for All FAD3 Products
Required fields are marked with *
0
Inquiry Basket