Recombinant Full Length Brassica Napus 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase 2(Lpat2) Protein, His-Tagged
Cat.No. : | RFL36318BF |
Product Overview : | Recombinant Full Length Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase 2(LPAT2) Protein (Q9XFW4) (1-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brassica napus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-390) |
Form : | Lyophilized powder |
AA Sequence : | MAMAAAVIVPLGILFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIV DWWAGVKIQVFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKS SKFLPVIGWSMWFSEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFVEGTRFTEAKL KAAQEYAASSELPVPRNVLIPRTKGFVSAVSNMRSFVPAIYDMTVAIPKTSPPPTMLRLF KGQPSVVHVHIKCHSMKDLPEPEDEIAQWCRDQFVAKDALLDKHIAADTFPGQKEQNIGR PIKSLAVVVSWACLLTLGAMKFLHWSNLFSSWKGIALSAFGLGIITLCMQILIRSSQSER STPAKVAPAKPKDNHQSGPSSQTEVEEKQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LPAT2 |
Synonyms | LPAT2; LPAAT2; 1-acyl-sn-glycerol-3-phosphate acyltransferase 2; Lysophosphatidyl acyltransferase 2 |
UniProt ID | Q9XFW4 |
◆ Recombinant Proteins | ||
PTZ4-P3-3880S | Recombinant Staphylococcus aureus (strain: TP4) PTZ4_P3 protein, His-tagged | +Inquiry |
GPBP1L1-2630R | Recombinant Rat GPBP1L1 Protein | +Inquiry |
NSP9-029V | Recombinant COVID-19 NSP9 protein, His-tagged | +Inquiry |
EHF-390H | Recombinant Human EHF Protein, His-tagged | +Inquiry |
DUSP5-11845Z | Recombinant Zebrafish DUSP5 | +Inquiry |
◆ Native Proteins | ||
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
ctxA-145V | Native Cholera Toxin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R3C-2920HCL | Recombinant Human PPP2R3C 293 Cell Lysate | +Inquiry |
SHOC2-1852HCL | Recombinant Human SHOC2 293 Cell Lysate | +Inquiry |
ATG4B-8624HCL | Recombinant Human ATG4B 293 Cell Lysate | +Inquiry |
PDGFRA-2657HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
ARL6IP5-36HCL | Recombinant Human ARL6IP5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPAT2 Products
Required fields are marked with *
My Review for All LPAT2 Products
Required fields are marked with *
0
Inquiry Basket