Recombinant Full Length Brassica Napus 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase 1, Chloroplastic(Lpat1) Protein, His-Tagged

• Cat.No.: RFL20649BF
• Product Overview: Recombinant Full Length Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic(LPAT1) Protein (Q9LLY4) (88-344aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Brassica napus
• Source: E.coli
• Tag: His
• ProteinLength: Full Length of Mature Protein (88-344)
• Form: Lyophilized powder
• AA Sequence: SDLSGAATPESTYPEPEIKLSSRLRGICFCLVAGISAIVLIVLMIIGHPFVLLFDRYRRK FHHFIAKLWASISIYPFYKTDIQGLENLPSSDTPCVYVSNHQSFLDIYTLLSLGQSYKFI SKTGIFVIPVIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELVKKGASVFFFPEGTRSKDG RLGPFKKGAFTIAAKTGVPVVPITLMGTGKIMPTGSEGILNHGDVRVIIHKPIYGSKADV LCEEARNKIAESMNLLS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: LPAT1
• Synonyms: BAT2; ACT2; LPAT1; BnaA03g50320D; GSBRNA2T00067440001; 1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic; Lysophosphatidyl acyltransferase 1; Protein BRASSICA ACYLTRANSFERASE 2
• UniProt ID: Q9LLY4