Recombinant Full Length Bovine Viral Diarrhea Virus Genome Polyprotein Protein, His-Tagged
Cat.No. : | RFL13877BF |
Product Overview : | Recombinant Full Length Bovine viral diarrhea virus Genome polyprotein Protein (P19711) (3270-3988aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine viral diarrhea virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (3270-3988) |
Form : | Lyophilized powder |
AA Sequence : | SSWFLKASNKQMSLTPLFEELLLRCPPATKSNKGHMASAYQLAQGNWEPLGCGVHLGTIP ARRVKIHPYEAYLKLKDFIEEEEKKPRVKDTVIREHNKWILKKIRFQGNLNTKKMLNPGK LSEQLDREGRKRNIYNHQIGTIMSSAGIRLEKLPIVRAQTDTKTFHEAIRDKIDKSENRQ NPELHNKLLEIFHTIAQPTLKHTYGEVTWEQLEAGVNRKGAAGFLEKKNIGEVLDSEKHL VEQLVRDLKAGRKIKYYETAIPKNEKRDVSDDWQAGDLVVEKRPRVIQYPEAKTRLAITK VMYNWVKQQPVVIPGYEGKTPLFNIFDKVRKEWDSFNEPVAVSFDTKAWDTQVTSKDLQL IGEIQKYYYKKEWHKFIDTITDHMTEVPVITADGEVYIRNGQRGSGQPDTSAGNSMLNVL TMMYGFCESTGVPYKSFNRVARIHVCGDDGFLITEKGLGLKFANKGMQILHEAGKPQKIT EGEKMKVAYRFEDIEFCSHTPVPVRWSDNTSSHMAGRDTAVILSKMATRLDSSGERGTTA YEKAVAFSFLLMYSWNPLVRRICLLVLSQQPETDPSKHATYYYKGDPIGAYKDVIGRNLS ELKRTGFEKLANLNLSLSTLGVWTKHTSKRIIQDCVAIGKEEGNWLVKPDRLISSKTGHL YIPDKGFTLQGKHYEQLQLRTETNPVMGVGTERYKLGPIVNLLLRRLKILLMTAVGVSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bovine viral diarrhea virus Genome polyprotein |
Synonyms | Genome polyprotein |
UniProt ID | P19711 |
◆ Recombinant Proteins | ||
RFL32706HF | Recombinant Full Length Human 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1(Srd5A1) Protein, His-Tagged | +Inquiry |
RFL31010HF | Recombinant Full Length Human Olfactory Receptor 6C74(Or6C74) Protein, His-Tagged | +Inquiry |
DACT3-4293M | Recombinant Mouse DACT3 Protein | +Inquiry |
ATP10A-9995H | Recombinant Human ATP10A, His-tagged | +Inquiry |
YRKC-3949B | Recombinant Bacillus subtilis YRKC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PILRA-001HCL | Recombinant Human PILRA cell lysate | +Inquiry |
SPOCK3-1505HCL | Recombinant Human SPOCK3 293 Cell Lysate | +Inquiry |
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
WIPI2-309HCL | Recombinant Human WIPI2 293 Cell Lysate | +Inquiry |
TCEANC2-8145HCL | Recombinant Human C1orf83 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Bovine viral diarrhea virus Genome polyprotein Products
Required fields are marked with *
My Review for All Bovine viral diarrhea virus Genome polyprotein Products
Required fields are marked with *
0
Inquiry Basket