Recombinant Full Length Bovine V-Type Proton Atpase 16 Kda Proteolipid Subunit(Atp6V0C) Protein, His-Tagged
Cat.No. : | RFL3341BF |
Product Overview : | Recombinant Full Length Bovine V-type proton ATPase 16 kDa proteolipid subunit(ATP6V0C) Protein (P23956) (1-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-155) |
Form : | Lyophilized powder |
AA Sequence : | MSEAKNGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP6V0C |
Synonyms | ATP6V0C; ATP6C; ATP6L; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit |
UniProt ID | P23956 |
◆ Recombinant Proteins | ||
RFL3341BF | Recombinant Full Length Bovine V-Type Proton Atpase 16 Kda Proteolipid Subunit(Atp6V0C) Protein, His-Tagged | +Inquiry |
ATP6V0C-542R | Recombinant Rat ATP6V0C Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V0C-5306C | Recombinant Chicken ATP6V0C | +Inquiry |
ATP6V0C-1526HF | Recombinant Full Length Human ATP6V0C Protein, GST-tagged | +Inquiry |
ATP6V0C-405H | Recombinant Human ATP6V0C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V0C-8589HCL | Recombinant Human ATP6V0C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6V0C Products
Required fields are marked with *
My Review for All ATP6V0C Products
Required fields are marked with *
0
Inquiry Basket