Recombinant Full Length Bovine Upf0458 Protein C7Orf42 Homolog Protein, His-Tagged
Cat.No. : | RFL11334BF |
Product Overview : | Recombinant Full Length Bovine UPF0458 protein C7orf42 homolog Protein (Q2YDM0) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MFNINPLENLKLYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLL RFNDLDLCVSENETLKHLTNDTAAPESTVTSGQARTSTQSPQPLEDAGPVNISVAITLTL DPLKPFGGYSRNVTHLYSTILGHQIGLSGREAQEEINITFTLPTSWSSDDCALHGHCEQV VFTACMTLTAHPGVFPVTVQPPHCVPDTYSNATLWYKIFTTARDANTKYAQDYNPFWCYK GAIGKVYHALNPKLTVIVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQS NPEFCPEKVALADA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM248 |
Synonyms | TMEM248; Transmembrane protein 248 |
UniProt ID | Q2YDM0 |
◆ Recombinant Proteins | ||
ALDH1L1-130R | Recombinant Rhesus Macaque ALDH1L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACPP-0310B | Recombinant Bacillus subtilis ACPP protein, His-tagged | +Inquiry |
MUS81-3824R | Recombinant Rat MUS81 Protein | +Inquiry |
AMD1-2483H | Recombinant Human Adenosylmethionine Decarboxylase 1, His-tagged | +Inquiry |
IRF1-3096R | Recombinant Rat IRF1 Protein | +Inquiry |
◆ Native Proteins | ||
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRRG4-2808HCL | Recombinant Human PRRG4 293 Cell Lysate | +Inquiry |
PAAF1-3477HCL | Recombinant Human PAAF1 293 Cell Lysate | +Inquiry |
TEX101-1143HCL | Recombinant Human TEX101 293 Cell Lysate | +Inquiry |
LAS1L-973HCL | Recombinant Human LAS1L cell lysate | +Inquiry |
CEP44-362HCL | Recombinant Human CEP44 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM248 Products
Required fields are marked with *
My Review for All TMEM248 Products
Required fields are marked with *
0
Inquiry Basket