Recombinant Full Length Bovine Transmembrane Protein 198(Tmem198) Protein, His-Tagged
Cat.No. : | RFL36398BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 198(TMEM198) Protein (Q08E36) (1-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-360) |
Form : | Lyophilized powder |
AA Sequence : | MPGTVATLRFQLLPPEPDDAFWGAPCEQPLERRYEALPALVCIMCCLFGVVYCFFGYRCF KAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFL VGLLLGLLLAAAALLGSAPYYQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTG AALIATAADYFAELLLLARYAVERLRAAPVPPLCWRSWALLALWPLLSLMGVLVQWRVTT ERDSHTEVVISRQRRRVQLMRIRQQEERKEKRRKKRPPRALPRGSRAPPRPGPPDPAYRR RPVPIKRFNGDILSPSYIQSFRDRQTGSSLSSFMASPTDADYEYGSRGPLTACSGPPVRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM198 |
Synonyms | TMEM198; Transmembrane protein 198 |
UniProt ID | Q08E36 |
◆ Recombinant Proteins | ||
C8B-618H | Recombinant Human C8B protein, His-tagged | +Inquiry |
Acsl6-1509M | Recombinant Mouse Acsl6 Protein, Myc/DDK-tagged | +Inquiry |
SNAPC2-2059H | Recombinant Human SNAPC2 Protein, MYC/DDK-tagged | +Inquiry |
CRISP1-1259R | Recombinant Rat CRISP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTRF1-2905R | Recombinant Rhesus monkey MTRF1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgM-337G | Native Goat IgM | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD2-9135HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
DIP2C-480HCL | Recombinant Human DIP2C cell lysate | +Inquiry |
BCAM-1708MCL | Recombinant Mouse BCAM cell lysate | +Inquiry |
CTSE-2190MCL | Recombinant Mouse CTSE cell lysate | +Inquiry |
FLJ10213-6194HCL | Recombinant Human FLJ10213 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM198 Products
Required fields are marked with *
My Review for All TMEM198 Products
Required fields are marked with *
0
Inquiry Basket