Recombinant Full Length Bovine Sterol-4-Alpha-Carboxylate 3-Dehydrogenase, Decarboxylating(Nsdhl) Protein, His-Tagged
Cat.No. : | RFL22472BF |
Product Overview : | Recombinant Full Length Bovine Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating(NSDHL) Protein (Q3ZBE9) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MEQAAGEPTRTCLTEDIPKAKRCTVIGGCGFLGQHMVEQLLARGYAVNVFDIRQGFDNPR VQFFLGDLCSQQDLYPALKGVSTVFHCASPPPFNNNKELFYRVNYIGTKNVIETCKEAGV QKLILTSSASVIFEGVDIKNGTEDLPYATKPIDYYTETKILQERAVLGAHDPEKNFLTTA IRPHGIFGPRDPQLVPILIEAAKKGKMKFMIGNGKNLVDFTFVENVVHGHILAAEHLSQD TALGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYWLAYYLALLVSLLVMVISPV IQLQPTFTPMRVALAGTFHYYSCEKAKKLMGYRPLVTMDDAVDKTVRSFHHLRKVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NSDHL |
Synonyms | NSDHL; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating |
UniProt ID | Q3ZBE9 |
◆ Recombinant Proteins | ||
ANXA10-579M | Recombinant Mouse ANXA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sulf2-666M | Recombinant Mouse Sulf2 Protein, His-tagged | +Inquiry |
MUDENG-2907R | Recombinant Rhesus monkey MUDENG Protein, His-tagged | +Inquiry |
IFNW1-3103H | Recombinant Human IFNW1 Protein (Leu22-Ser195), C-His tagged | +Inquiry |
MIEF2-4532Z | Recombinant Zebrafish MIEF2 | +Inquiry |
◆ Native Proteins | ||
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
Lectin-1745S | Active Native Sambucus Nigra Lectin Protein | +Inquiry |
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Medulla Oblongata-34H | Human Medulla Oblongata Tissue Lysate | +Inquiry |
ZNF174-135HCL | Recombinant Human ZNF174 293 Cell Lysate | +Inquiry |
MET-2047MCL | Recombinant Mouse MET cell lysate | +Inquiry |
CST3-2991HCL | Recombinant Human CST3 cell lysate | +Inquiry |
MOBKL2B-4264HCL | Recombinant Human MOBKL2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSDHL Products
Required fields are marked with *
My Review for All NSDHL Products
Required fields are marked with *
0
Inquiry Basket