Recombinant Full Length Bovine Protein Phosphatase 1L(Ppm1L) Protein, His-Tagged
Cat.No. : | RFL18794BF |
Product Overview : | Recombinant Full Length Bovine Protein phosphatase 1L(PPM1L) Protein (A5PJZ2) (1-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-360) |
Form : | Lyophilized powder |
AA Sequence : | MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKSHNVAVYSIQGRRDHMEDRFEVLMDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKDRLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PPM1L |
Synonyms | PPM1L; PP2CE; Protein phosphatase 1L; Protein phosphatase 1-like; Protein phosphatase 2C isoform epsilon; PP2C-epsilon |
UniProt ID | A5PJZ2 |
◆ Recombinant Proteins | ||
RFL18794BF | Recombinant Full Length Bovine Protein Phosphatase 1L(Ppm1L) Protein, His-Tagged | +Inquiry |
PPM1L-13204M | Recombinant Mouse PPM1L Protein | +Inquiry |
PPM1L-6995M | Recombinant Mouse PPM1L Protein, His (Fc)-Avi-tagged | +Inquiry |
Ppm1l-5052M | Recombinant Mouse Ppm1l Protein, Myc/DDK-tagged | +Inquiry |
PPM1L-80H | Recombinant Human PPM1L protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPM1L-2956HCL | Recombinant Human PPM1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPM1L Products
Required fields are marked with *
My Review for All PPM1L Products
Required fields are marked with *
0
Inquiry Basket