Recombinant Full Length Bovine Protein Mal2(Mal2) Protein, His-Tagged
Cat.No. : | RFL166BF |
Product Overview : | Recombinant Full Length Bovine Protein MAL2(MAL2) Protein (A2VE13) (1-176aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-176) |
Form : | Lyophilized powder |
AA Sequence : | MSAGGAPVPPPPNPAMSFPAPRVTLPAGPDILRTYSGAFVCLEIVFGGLVWILVASSNVP LPLLQGWVMFVSVTAFVCSLLFLGVFLSGVVTQINANWNFLDFAYHFTVFVFYFGAFLLE AATTSLHDLRCNRTMTVQPLLSDNQYNINVAATIFAFVTTACYGCSLGLALRRWRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MAL2 |
Synonyms | MAL2; Protein MAL2 |
UniProt ID | A2VE13 |
◆ Native Proteins | ||
IgG-147R | Native Rabbit IgG Fab fragment | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCAM1-858RCL | Recombinant Rat NCAM1 cell lysate | +Inquiry |
MS4A2-4126HCL | Recombinant Human MS4A2 293 Cell Lysate | +Inquiry |
ACSL4-9075HCL | Recombinant Human ACSL4 293 Cell Lysate | +Inquiry |
CARD11-7850HCL | Recombinant Human CARD11 293 Cell Lysate | +Inquiry |
Diaphragm-607R | Rat Diaphragm Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAL2 Products
Required fields are marked with *
My Review for All MAL2 Products
Required fields are marked with *
0
Inquiry Basket