Recombinant Full Length Human MAL2 Protein, GST-tagged

Cat.No. : MAL2-6874HF
Product Overview : Human MAL2 full-length ORF ( AAH12367, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 176 amino acids
Description : This gene encodes a multispan transmembrane protein belonging to the MAL proteolipid family. The protein is a component of lipid rafts and, in polarized cells, it primarily localizes to endosomal structures beneath the apical membrane. It is required for transcytosis, an intracellular transport pathway used to deliver membrane-bound proteins and exogenous cargos from the basolateral to the apical surface.
Molecular Mass : 44.99 kDa
AA Sequence : MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MAL2 mal, T cell differentiation protein 2 [ Homo sapiens (human) ]
Official Symbol MAL2
Synonyms MAL2; mal, T cell differentiation protein 2; protein MAL2; MAL proteolipid protein 2; MAL2 proteolipid protein; myelin and lymphocyte protein
Gene ID 114569
mRNA Refseq NM_052886
Protein Refseq NP_443118
MIM 609684
UniProt ID Q969L2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAL2 Products

Required fields are marked with *

My Review for All MAL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon