Recombinant Full Length Human MAL2 Protein, GST-tagged

• Cat.No.: MAL2-6874HF
• Product Overview: Human MAL2 full-length ORF ( AAH12367, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 176 amino acids
• Description: This gene encodes a multispan transmembrane protein belonging to the MAL proteolipid family. The protein is a component of lipid rafts and, in polarized cells, it primarily localizes to endosomal structures beneath the apical membrane. It is required for transcytosis, an intracellular transport pathway used to deliver membrane-bound proteins and exogenous cargos from the basolateral to the apical surface.
• Molecular Mass: 44.99 kDa
• AA Sequence: MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MAL2 mal, T cell differentiation protein 2 [ Homo sapiens (human) ]
• Official Symbol: MAL2
• Synonyms: MAL2; mal, T cell differentiation protein 2; protein MAL2; MAL proteolipid protein 2; MAL2 proteolipid protein; myelin and lymphocyte protein
• Gene ID: 114569
• mRNA Refseq: NM_052886
• Protein Refseq: NP_443118
• MIM: 609684
• UniProt ID: Q969L2