Recombinant Full Length Bovine Prokineticin Receptor 2(Prokr2) Protein, His-Tagged
Cat.No. : | RFL23316BF |
Product Overview : | Recombinant Full Length Bovine Prokineticin receptor 2(PROKR2) Protein (Q8SPN1) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli expression system |
Species : | Bos taurus (Bovine) |
Tag : | His |
Form : | Lyophilized powder |
Protein length : | Full Length (1-384) |
AA Sequence : | MAAQNGNASFPANFSIPQEHASSLPFNFSYDDYDLPLDEDEDMTKTQTFFAAKIVIGVAL VGIMLTCGIGNFVFITALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVHQLS WEHGHVLCACINYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILISIPSAYFTKETVLFIVKNQKKIFCGQVWPVDQQLYYKSYFLFVFGIEFLGPVFTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNSTMKYFKKMLLLHWRPSHHGSK SSADLDLKTSRLPATEEVDCIRLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PROKR2 |
Synonyms | PROKR2; GPR73L1; PKR2; Prokineticin receptor 2; PK-R2; G-protein coupled receptor 73-like 1; G-protein coupled receptor I5E |
UniProt ID | Q8SPN1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PROKR2 Products
Required fields are marked with *
My Review for All PROKR2 Products
Required fields are marked with *
0
Inquiry Basket