Recombinant Full Length Bovine L-Gulonolactone Oxidase(Gulo) Protein, His-Tagged
Cat.No. : | RFL18500BF |
Product Overview : | Recombinant Full Length Bovine L-gulonolactone oxidase(GULO) Protein (Q3ZC33) (1-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (1-440) |
Form : | Lyophilized powder |
AA Sequence : | MVHGYKGVKFQNWARTYGCCPEMYFQPTSVEEVREVLALARQQNKRVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLKVDTEKKQVTVEAGILLADLHPQLDKHGLALSNLGAVSDVTAGGV IGSGTHNTGIKHGILATQVVALTLLTANGTILECSESSNAEVFQAARVHLGCLGVILTVT LQCVPQFHLQETTFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSVIYQDHTNKPPSS SANWFWDYAIGFYLLEFLLWISTFLPGLVGWINRFFFWLLFNGKKENCNLSHKIFTYECR FKQHVQDWAIPREKTKEALLELKAMLEANPKVVAHYPVEVRFTRGDDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKVGGRPHWAKAHNCTRKDFEKMYPAFQRFCAIR EKLDPTGMFLNAYLEKVFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GULO |
Synonyms | GULO; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO |
UniProt ID | Q3ZC33 |
◆ Recombinant Proteins | ||
GUCY1A3-4009M | Recombinant Mouse GUCY1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PVRL2-2680H | Recombinant Human PVRL2 Protein (Gln32-Pro350), His tagged | +Inquiry |
DUS4L-2920H | Recombinant Human DUS4L Protein, GST-tagged | +Inquiry |
LEPR-1236H | Recombinant Human LEPR Protein (Gly310-Leu538), N-His tagged | +Inquiry |
YQHR-3840B | Recombinant Bacillus subtilis YQHR protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Protein C-89H | Native Human Protein C | +Inquiry |
ACTB-882P | Native Porcine ACTB Protein | +Inquiry |
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
VTN-3H | Native Human multimeric vitronectin, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTUD6B-3514HCL | Recombinant Human OTUD6B 293 Cell Lysate | +Inquiry |
HA-2701HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
PKP4-3146HCL | Recombinant Human PKP4 293 Cell Lysate | +Inquiry |
ODF3-3597HCL | Recombinant Human ODF3 293 Cell Lysate | +Inquiry |
TMED8-1022HCL | Recombinant Human TMED8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GULO Products
Required fields are marked with *
My Review for All GULO Products
Required fields are marked with *
0
Inquiry Basket