Recombinant Full Length Rat L-Gulonolactone Oxidase(Gulo) Protein, His-Tagged
Cat.No. : | RFL27296RF |
Product Overview : | Recombinant Full Length Rat L-gulonolactone oxidase(Gulo) Protein (P10867) (2-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-440) |
Form : | Lyophilized powder |
AA Sequence : | VHGYKGVQFQNWAKTYGCSPEVYYQPTSVEEVREVLALAREQKKKVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLQVDKEKKQITVEAGILLADLHPQLDEHGLAMSNLGAVSDVTVAGV IGSGTHNTGIKHGILATQVVALTLMTADGEVLECSESRNADVFQAARVHLGCLGIILTVT LQCVPQFHLQETSFPSTLKEVLDNLDSHLKRSEYFRFLWFPHTENVSIIYQDHTNKAPSS ASNWFWDYAIGFYLLEFLLWTSTYLPCLVGWINRFFFWMLFNCKKESSNLSHKIFTYECR FKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRGDDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHNCTQKDFEEMYPTFHKFCDIR EKLDPTGMFLNSYLEKVFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gulo |
Synonyms | Gulo; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO |
UniProt ID | P10867 |
◆ Recombinant Proteins | ||
HES3-4703H | Recombinant Human HES3 Protein, GST-tagged | +Inquiry |
CXCL10-4341D | Recombinant Dolphin CXCL10 Protein | +Inquiry |
ARSA-2502H | Recombinant Human ARSA Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC8-1196R | Recombinant Rat CCDC8 Protein | +Inquiry |
RFL21008EF | Recombinant Full Length Emericella Nidulans Ph-Response Regulator Protein Pali/Rim9(Pali) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PLG-30083TH | Native Human PLG | +Inquiry |
DAO1-25P | Active Native Porcine D-Amino acid oxidase | +Inquiry |
GPD-189R | Active Native Rabbit Glycerol-3-phosphate dehydrogenase | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSGIN2-3525HCL | Recombinant Human OSGIN2 293 Cell Lysate | +Inquiry |
C1QBP-229HCL | Recombinant Human C1QBP cell lysate | +Inquiry |
RPL34-2202HCL | Recombinant Human RPL34 293 Cell Lysate | +Inquiry |
CH25H-7549HCL | Recombinant Human CH25H 293 Cell Lysate | +Inquiry |
MPZL1-4218HCL | Recombinant Human MPZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gulo Products
Required fields are marked with *
My Review for All Gulo Products
Required fields are marked with *
0
Inquiry Basket