Recombinant Full Length Bovine Glycerol-3-Phosphate Acyltransferase 4(Agpat6) Protein, His-Tagged
Cat.No. : | RFL-10BF |
Product Overview : | Recombinant Full Length Bovine Glycerol-3-phosphate acyltransferase 4(AGPAT6) Protein (A3FPG8) (38-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (38-456) |
Form : | Lyophilized powder |
AA Sequence : | VSFGIRKLYMKTLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRR SGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYIS LRLTVLWGLGVLIRYCLLLSLRIALAFTGISLLVVGTTMVGYLPNGRFKEFLSKHVHLMC YRICVRALTAIITYHDRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVI QRAMVKACPHVWFERSEVKDRHLVARRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKG SFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQAEE DAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT4 |
Synonyms | GPAT4; AGPAT6; Glycerol-3-phosphate acyltransferase 4; GPAT4; 1-acylglycerol-3-phosphate O-acyltransferase 6; 1-AGP acyltransferase 6; 1-AGPAT 6; Acyl-CoA:glycerol-3-phosphate acyltransferase 4; Lysophosphatidic acid acyltransferase zeta; LPAAT-zeta |
UniProt ID | A3FPG8 |
◆ Recombinant Proteins | ||
CNPY2-1919HF | Recombinant Full Length Human CNPY2 Protein, GST-tagged | +Inquiry |
B5R-221M | Recombinant Monkeypox virus B5R Protein, His and Sumo-tagged | +Inquiry |
SPAG1-8604M | Recombinant Mouse SPAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM62-3418H | Recombinant Human TRIM62 protein, GST-tagged | +Inquiry |
KIT-1547R | Recombinant Rhesus Monkey KIT Protein | +Inquiry |
◆ Native Proteins | ||
PLG-27842TH | Native Human PLG | +Inquiry |
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB5-5859HCL | Recombinant Human GNB5 293 Cell Lysate | +Inquiry |
EIF3J-6657HCL | Recombinant Human EIF3J 293 Cell Lysate | +Inquiry |
MPHOSPH6-4238HCL | Recombinant Human MPHOSPH6 293 Cell Lysate | +Inquiry |
LRRC32-4635HCL | Recombinant Human LRRC32 293 Cell Lysate | +Inquiry |
ELF4-6631HCL | Recombinant Human ELF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT4 Products
Required fields are marked with *
My Review for All GPAT4 Products
Required fields are marked with *
0
Inquiry Basket