Recombinant Human TRIM62 protein, GST-tagged
Cat.No. : | TRIM62-3418H |
Product Overview : | Recombinant Human TRIM62(1 a.a. - 475 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
ProteinLength : | 1-475 a.a. |
Description : | TRIM62 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 80.7 kDa |
AA Sequence : | MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEPALAPSLKLANIVERY SSFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQALQDSE REHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKV QEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEKTQWVIGLAHEAASRK GSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFLDYDQGLLIFYNADDMSWLYTFREKFPGKLC SYFSPGQSHANGKNVQPLRINTVRI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TRIM62 tripartite motif containing 62 [ Homo sapiens ] |
Official Symbol | TRIM62 |
Synonyms | TRIM62; tripartite motif containing 62; tripartite motif-containing protein 62; DEAR1; ductal epithelium associated RING Chromosome 1; FLJ10759; tripartite motif-containing 62; ductal epithelium-associated RING Chromosome 1; FLJ16558; |
Gene ID | 55223 |
mRNA Refseq | NM_018207 |
Protein Refseq | NP_060677 |
MIM | |
UniProt ID | Q9BVG3 |
Chromosome Location | 1p35.1 |
Function | metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
PPP1CC-2401H | Recombinant Human Protein Phosphatase 1, Catalytic Subunit, Gamma Isozyme, His-tagged | +Inquiry |
RFL31229MF | Recombinant Full Length Mouse Protein Lifeguard 4(Tmbim4) Protein, His-Tagged | +Inquiry |
CNTNAP1-952R | Recombinant Rhesus monkey CNTNAP1 Protein, His-tagged | +Inquiry |
PDCD1LG2-5132H | Recombinant Human PDCD1LG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Capn1-2030M | Recombinant Mouse Capn1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CII-250C | Native Chicken CII | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
IgG-343M | Native MONKEY IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIAA1199-915HCL | Recombinant Human KIAA1199 cell lysate | +Inquiry |
AQP10-8769HCL | Recombinant Human AQP10 293 Cell Lysate | +Inquiry |
SH3BP1-1872HCL | Recombinant Human SH3BP1 293 Cell Lysate | +Inquiry |
NGFR-1670HCL | Recombinant Human NGFR cell lysate | +Inquiry |
SERPINA3C-2499MCL | Recombinant Mouse SERPINA3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM62 Products
Required fields are marked with *
My Review for All TRIM62 Products
Required fields are marked with *
0
Inquiry Basket