Recombinant Human GSG1 Protein, GST-tagged

• Cat.No.: GSG1-4392H
• Product Overview: Human GSG1 full-length ORF ( AAH01796.1, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GSG1 (Germ Cell Associated 1) is a Protein Coding gene. GO annotations related to this gene include RNA polymerase binding. An important paralog of this gene is GSG1L.
• Molecular Mass: 57.5 kDa
• AA Sequence: MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSG1 germ cell associated 1 [ Homo sapiens ]
• Official Symbol: GSG1
• Synonyms: GSG1; germ cell associated 1; germ cell-specific gene 1 protein; MGC3146; MGC111023
• Gene ID: 83445
• mRNA Refseq: NM_001080554
• Protein Refseq: NP_001074023
• UniProt ID: Q2KHT4