Recombinant Full Length Bovine Dihydroorotate Dehydrogenase (Quinone), Mitochondrial(Dhodh) Protein, His-Tagged
Cat.No. : | RFL30566BF |
Product Overview : | Recombinant Full Length Bovine Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) Protein (Q5E9W3) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MAWRQLKKRAQDAMVILGGGGLLFASYLTATGDEHFYAELLMPSLQRLLDPETAHRLAVR FTSLGLLPRTTFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSV TPEPQEGNPRPRVFRLPEDQAIINRYGFNSHGLSVVEHRLRARQQTQARLTEDGLPLGIN LGKNKTSVDAASDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQER DALKVAHKPAVLVKIAPDLTAQDKEDIASVVRELGIDGLIVTNSTVSRPASLQGALRSEP GGLSGKPLRDLSTQTIREMYALTQGRVPIVGVGGVSSGQDALEKIRAGASLVQLYTALTY RGPPVVGGVKRELEALLKEQGFARVTDAIGADHRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DHODH |
Synonyms | DHODH; Dihydroorotate dehydrogenase; quinone, mitochondrial; DHOdehase; Dihydroorotate oxidase |
UniProt ID | Q5E9W3 |
◆ Recombinant Proteins | ||
BIRC2-0713H | Recombinant Human BIRC2 Protein (M1-S618), Tag Free | +Inquiry |
RFL30135MF | Recombinant Full Length Uncharacterized Protein Mb0898C (Mb0898C) Protein, His-Tagged | +Inquiry |
CASKIN1-1126H | Recombinant Human CASKIN1 | +Inquiry |
SEL1L2-1219H | Recombinant Human SEL1L2 | +Inquiry |
SKINT9-15183M | Recombinant Mouse SKINT9 Protein | +Inquiry |
◆ Native Proteins | ||
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
Collagen-45R | Native Rat Collagen I | +Inquiry |
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKA-6960HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
ASB4-8662HCL | Recombinant Human ASB4 293 Cell Lysate | +Inquiry |
Rectum-54H | Human Rectum Tumor Tissue Lysate | +Inquiry |
NTNG1-3667HCL | Recombinant Human NTNG1 293 Cell Lysate | +Inquiry |
CTSB-3025HCL | Recombinant Human CTSB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHODH Products
Required fields are marked with *
My Review for All DHODH Products
Required fields are marked with *
0
Inquiry Basket