Recombinant Full Length Bovine Coronavirus Membrane Protein(M) Protein, His-Tagged
Cat.No. : | RFL18229BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Membrane protein(M) Protein (P69705) (1-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-230) |
Form : | Lyophilized powder |
AA Sequence : | MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMFVYVIKMIILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKVS HLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; 6; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein |
UniProt ID | P69705 |
◆ Recombinant Proteins | ||
PCSK4-12516M | Recombinant Mouse PCSK4 Protein | +Inquiry |
CASP9-584H | Recombinant Human CASP9 | +Inquiry |
Gp6-5622M | Active Recombinant Mouse Glycoprotein 6 (platelet), His-tagged | +Inquiry |
TNFRSF21-6199R | Recombinant Rat TNFRSF21 Protein | +Inquiry |
SLC25A38B-7978Z | Recombinant Zebrafish SLC25A38B | +Inquiry |
◆ Native Proteins | ||
TTR-141S | Native Sheep prealbumin | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
IgG2A-015M | Native Mouse IgG2A Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF7-1266HCL | Recombinant Human TAF7 293 Cell Lysate | +Inquiry |
ZNF74-2083HCL | Recombinant Human ZNF74 cell lysate | +Inquiry |
CCDC96-165HCL | Recombinant Human CCDC96 lysate | +Inquiry |
IDO1-5300HCL | Recombinant Human IDO1 293 Cell Lysate | +Inquiry |
Umbilical Cord-11H | Human Fetal Umbilical Cord Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket