Recombinant Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) M protein, His&Myc-tagged

• Cat.No.: M-4372I
• Product Overview: Recombinant Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) M protein(P06821)(44-97aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 44-97aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 13.8 kDa
• AA Sequence: DRLFFKCIYRRFKYGLKGGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.