Recombinant Full Length Influenza A Virus Matrix Protein 2(M) Protein, His-Tagged
Cat.No. : | RFL22939IF |
Product Overview : | Recombinant Full Length Influenza A virus Matrix protein 2(M) Protein (Q20PM2) (1-97aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Grey teal/Australia/2/1979 H4N4) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-97) |
Form : | Lyophilized powder |
AA Sequence : | MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; Matrix protein 2; Proton channel protein M2 |
UniProt ID | Q20PM2 |
◆ Recombinant Proteins | ||
PIGP-3113H | Recombinant Human PIGP protein, His-tagged | +Inquiry |
fimC-3482E | Recombinant Escherichia coli (strain K12) fimC protein(37-241aa), GST-tagged | +Inquiry |
MAPK8IP1-711H | Recombinant Human MAPK8IP1 | +Inquiry |
MYH7B-6156C | Recombinant Chicken MYH7B | +Inquiry |
Spn-2094M | Recombinant Mouse Spn Protein, His&GST-tagged | +Inquiry |
◆ Native Proteins | ||
Hyaluronidase-34O | Active Native Ovine Hyaluronidase | +Inquiry |
C1q-04M | Native Mouse C1q Protein | +Inquiry |
CTSH-190H | Active Native Human Cathepsin H | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart Atrium-200H | Human Heart Atrium (LT) (Arrhythmia, infarct) Lysate | +Inquiry |
SEC11C-2001HCL | Recombinant Human SEC11C 293 Cell Lysate | +Inquiry |
ARHGEF2-8732HCL | Recombinant Human ARHGEF2 293 Cell Lysate | +Inquiry |
ATP5B-8605HCL | Recombinant Human ATP5B 293 Cell Lysate | +Inquiry |
Blood-601R | Rat Blood Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket