Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL15283BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (Q66165) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FENPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYNNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q66165 |
◆ Recombinant Proteins | ||
CD8A-1461H | Recombinant Human CD8A Protein (Ser22-Asp182), N-His tagged | +Inquiry |
PAX9-3131R | Recombinant Rhesus Macaque PAX9 Protein, His (Fc)-Avi-tagged | +Inquiry |
L3MBTL3-8918M | Recombinant Mouse L3MBTL3 Protein | +Inquiry |
ATF1-265R | Recombinant Rhesus Macaque ATF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OSBP2-12196M | Recombinant Mouse OSBP2 Protein | +Inquiry |
◆ Native Proteins | ||
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
ALPL-8004H | Native Human Liver Alkaline Phosphatase | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD1LG2-1738MCL | Recombinant Mouse PDCD1LG2 cell lysate | +Inquiry |
ZNF615-37HCL | Recombinant Human ZNF615 293 Cell Lysate | +Inquiry |
FAM161A-6418HCL | Recombinant Human FAM161A 293 Cell Lysate | +Inquiry |
PIWIL4-3161HCL | Recombinant Human PIWIL4 293 Cell Lysate | +Inquiry |
VAT1-425HCL | Recombinant Human VAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket