Recombinant Full Length Bovine Cd320 Antigen(Cd320) Protein, His-Tagged
Cat.No. : | RFL2300BF |
Product Overview : | Recombinant Full Length Bovine CD320 antigen(CD320) Protein (A6QNY1) (30-255aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (30-255) |
Form : | Lyophilized powder |
AA Sequence : | LEIAPTPIQTWSPTQAPGPSAGSCPPTNFQCRSDGRCLPLIWRCDVDQDCPDGSDEEECGTEVPNGSPSPCDIMDDCPDHNKNLLNCGPQSCPEGELCCPLDGVCIPSTWLCDGHRDCSDYSDELGCGTKTHEEGRTMSTGTPVTLENVTYLSNATVTAIEDWDSVQSGNRNVYGIIAAVAVLSISLAAGILFALSRLCAQGCLAPLGLLVSMKGSLQPEKKTSVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD320 |
Synonyms | CD320; CD320 antigen; Transcobalamin receptor; TCblR; CD antigen CD320 |
UniProt ID | A6QNY1 |
◆ Recombinant Proteins | ||
CD320-1728R | Recombinant Rhesus Monkey CD320 Protein | +Inquiry |
CD320-3160HF | Recombinant Full Length Human CD320 Protein, GST-tagged | +Inquiry |
CD320-1458M | Recombinant Mouse CD320 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd320-979M | Recombinant Mouse Cd320 Protein, Fc-tagged | +Inquiry |
RFL15413RF | Recombinant Full Length Rat Cd320 Antigen(Cd320) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD320-001MCL | Recombinant Mouse CD320 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD320 Products
Required fields are marked with *
My Review for All CD320 Products
Required fields are marked with *
0
Inquiry Basket