Recombinant Full Length Bovine Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3(Bnip3) Protein, His-Tagged
Cat.No. : | RFL12145BF |
Product Overview : | Recombinant Full Length Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3(BNIP3) Protein (Q32KN2) (1-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-196) |
Form : | Lyophilized powder |
AA Sequence : | MSQSESPGLQEESLHGSWVELHFGSNGNGSSVPDSVSIYKGDMEKILLDAQHESGRSSSK SSHCDSPPRSQTPQDTNRASETDTHSLGEKNSSQSEEDYMERRKEVESILKKNSDWIWDW SSRPENVPPAKEFLLFKHPKRTPTLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIG LGIYIGRRLTTSTSTF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BNIP3 |
Synonyms | BNIP3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 |
UniProt ID | Q32KN2 |
◆ Recombinant Proteins | ||
BNIP3-2448M | Recombinant Mouse BNIP3 Protein | +Inquiry |
BNIP3-294H | Recombinant Human BNIP3 Protein, GST-tagged | +Inquiry |
Bnip3-1684R | Recombinant Rat Bnip3 protein, His & GST-tagged | +Inquiry |
RFL18293HF | Recombinant Full Length Human Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3(Bnip3) Protein, His-Tagged | +Inquiry |
Bnip3-2354M | Recombinant Mouse Bnip3 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BNIP3 Products
Required fields are marked with *
My Review for All BNIP3 Products
Required fields are marked with *
0
Inquiry Basket