Recombinant Full Length Bovine Adp/Atp Translocase 3(Slc25A6) Protein, His-Tagged

• Cat.No.: RFL10343BF
• Product Overview: Recombinant Full Length Bovine ADP/ATP translocase 3(SLC25A6) Protein (P32007) (2-298aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His
• Protein Length: Full Length of Mature Protein (2-298)
• Form: Lyophilized powder
• AA Sequence: TEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRI PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKSGSEREFRGLGDCLVKITKSDGIRGLYQGFNVSV QGIIIYRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQ SGRKGADIMYKGTVDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: SLC25A6
• Synonyms: SLC25A6; AAC3; ANT3; ADP/ATP translocase 3; ADP,ATP carrier protein 3; ADP,ATP carrier protein, isoform T2; ANT 2; Adenine nucleotide translocator 3; ANT 3; Solute carrier family 25 member 6
• UniProt ID: P32007