Recombinant Full Length Borrelia Burgdorferi Protein Hflk(Hflk) Protein, His-Tagged
Cat.No. : | RFL2148BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Protein HflK(hflK) Protein (O51221) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MFDIKQIFNKTYEYLIIIITLILISIIVIANIFIVGPSEEAIVLRLGKLNRTLDSGIHVK IPLIEEKFIVPVKIVQEIKFGFLISPSDIRENDNANDESRIITGDLNIINIEWLVQYKIR DPYSFKFKVEDPETTIKDIAKSSMNRLIGDNTIFEIINDNRVGITEGVKSSMNEIIDNYN LGIDVVQVQIRNALPPKGKVYEAFEDVNIAIQDKNKYINEGRKEFNQIVPKIKGEALKVI EEARGYKESRINNALADTEIFNAILDAYLKNPDITKERLYNETMKEILENKDNIELIDKN FKNFLPFKEVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hflK |
Synonyms | hflK; BB_0203; Protein HflK |
UniProt ID | O51221 |
◆ Native Proteins | ||
Lectin-1715U | Native Ulex europaeus Lectin, FITC conjugated | +Inquiry |
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
FGA-58R | Native Rabbit Fibrinogen | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMT112-756HCL | Recombinant Human TRMT112 293 Cell Lysate | +Inquiry |
BCAR3-8497HCL | Recombinant Human BCAR3 293 Cell Lysate | +Inquiry |
SLC19A3-599HCL | Recombinant Human SLC19A3 lysate | +Inquiry |
CD4-1905HCL | Recombinant Human CD4 cell lysate | +Inquiry |
DYX1C1-6747HCL | Recombinant Human DYX1C1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hflK Products
Required fields are marked with *
My Review for All hflK Products
Required fields are marked with *
0
Inquiry Basket