Recombinant Full Length Colwellia Psychrerythraea Lipid A Export Atp-Binding/Permease Protein Msba 2(Msba2) Protein, His-Tagged
Cat.No. : | RFL4490CF |
Product Overview : | Recombinant Full Length Colwellia psychrerythraea Lipid A export ATP-binding/permease protein MsbA 2(msbA2) Protein (Q480N3) (1-584aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Colwellia Psychrerythraea |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-584) |
Form : | Lyophilized powder |
AA Sequence : | MTQVSKTIAKPSGNANLYSRLFSYYRVYKKLIFIALAGLCLFSFVDAGMIYFVKPLIDQG LSKADSHTLQLGALLVVAIFFLRGIASFTSSYAIAYISSKVTYRIRQQAFDKLLYLPRTY FDLNSRGSLISKIIYDTEQLSQSFSSAVVIAIRESVIILVLFSMMVYNSWQLTAIFLVIV PIIALIINKVSKRFKNISHKLQNSMGQVSNKTEQAILNQQEIVLLDTRTQISAQFEKTNN NNRQQNMKLQATSAISNPVIQLIASFAIAAVLLLASIDQVLNQLTPGSFTLILIAMGSLL KPLKQLSNINQQLQKGLIAAKSLFSFLDQQEEHDIGTKQLSKTCSNIRFNNFSFTYQGKT QPALSNFSLQIKGGTSVAFVGESGSGKSTLARLLLRLYQSPKQSILINDIAIEDYSLSSL RAQFAFVSQDIVLIDDTLANNISFGCNRDVTDSEIEQAAINANVMAFAKELPLGLNSEIG ENGRNLSGGQRQRIAIARAMLRDASIIVLDEATSALDNHSEKHIQQALTRLTQHKTVLII AHKLSSIQHVDEIIVINKGRLIEQGNHKTLQAKAGYYQSLYQSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA2 |
Synonyms | msbA2; CPS_2774; ATP-dependent lipid A-core flippase 2; Lipid A export ATP-binding/permease protein MsbA 2 |
UniProt ID | Q480N3 |
◆ Recombinant Proteins | ||
UHRF1-243H | Recombinant Full Length Human UHRF1 Protein, His-tagged | +Inquiry |
TMED7-TICAM2-1088H | Recombinant Human TMED7 Protein, MYC/DDK-tagged | +Inquiry |
Furin-3106M | Recombinant Mouse Furin Protein, Myc/DDK-tagged | +Inquiry |
CTF1-8450H | Active Recombinant Human CTF1, His-tagged | +Inquiry |
IL17RA-2197H | Active Recombinant Human IL17RA protein(Met1-Trp320), His-tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
Hb-001H | Native Human Hb Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX9-3411HCL | Recombinant Human PAX9 293 Cell Lysate | +Inquiry |
GCA-5994HCL | Recombinant Human GCA 293 Cell Lysate | +Inquiry |
IL4I1-5225HCL | Recombinant Human IL4I1 293 Cell Lysate | +Inquiry |
Fetus-186M | Mouse Fetus (15 Day Fetus) Membrane Lysate | +Inquiry |
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA2 Products
Required fields are marked with *
My Review for All msbA2 Products
Required fields are marked with *
0
Inquiry Basket