Recombinant Full Length Bordetella Pertussis Type Iv Secretion System Protein Ptlg(Ptlg) Protein, His-Tagged
Cat.No. : | RFL7511BF |
Product Overview : | Recombinant Full Length Bordetella pertussis Type IV secretion system protein ptlG(ptlG) Protein (Q7VSX4) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella pertussis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MLNRPSSPDGGEAHAWPPDPEIPVFANAEHAHRRPLRWMFALVAVALSCLLATGIWRSRA APPHAATQTVAPAGQALPPGRIFTVHPREPEPAPLPDMPAAPDPILPQPRPAPPVPPPPI RAPYDYDEPAPRRDSAALKSGPAMMVATAARLGQTERAGMADDGVSADAATLIGRNVSRA TRSGGRDYRLLPGTFIDCILQTRIVTNVPGLTTCIVSRDVYSASGKRVLVPRGTTVVGEY RADLAQGSQRIYVAWSRLFMPSGLTIELASPAVDGTGAAGLPGVVDDKFAQRFGGALLLS VLGDATSYMLARATDARHGVNVNLTAAGTMNSLAASALNNTINIPPTLYKNHGDQIGILV ARPLDFSILRGTNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ptlG |
Synonyms | ptlG; BP3795; Type IV secretion system protein PtlG; Pertussis toxin liberation protein G |
UniProt ID | Q7VSX4 |
◆ Recombinant Proteins | ||
GALNTL5-3457M | Recombinant Mouse GALNTL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLMP-5663H | Recombinant Human CLMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRTAM-1912H | Recombinant Human CRTAM Protein | +Inquiry |
NONO-28748TH | Recombinant Human NONO, His-tagged | +Inquiry |
RFL35310TF | Recombinant Full Length Treponema Pallidum Protein Hflc(Hflc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-26392TH | Native Human ORM1 | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
pepsin -173P | Native Pig pepsin | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF200-126HCL | Recombinant Human ZNF200 293 Cell Lysate | +Inquiry |
HMGN4-5471HCL | Recombinant Human HMGN4 293 Cell Lysate | +Inquiry |
TAF1C-1733HCL | Recombinant Human TAF1C cell lysate | +Inquiry |
HSF2BP-5365HCL | Recombinant Human HSF2BP 293 Cell Lysate | +Inquiry |
GNA12-719HCL | Recombinant Human GNA12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ptlG Products
Required fields are marked with *
My Review for All ptlG Products
Required fields are marked with *
0
Inquiry Basket