Recombinant Full Length Treponema Pallidum Protein Hflc(Hflc) Protein, His-Tagged
Cat.No. : | RFL35310TF |
Product Overview : | Recombinant Full Length Treponema pallidum Protein HflC(hflC) Protein (O83152) (1-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-331) |
Form : | Lyophilized powder |
AA Sequence : | MRKRGLQVHARVRPVLNIGIVVGVLLGGVVLLQPFYLIQEGQVALITQFGEIIKTNNTAG LYVRAPFLHHVHKYTAKLLRVDGDPQKIPTKEKQFIEVDTTSRWRIEDVKKFYQSLGTYE AAYSRISDIIDSSVRDIITVNGLDDVVRSTNAINESNHSEQFDVPVSQLAFDRGAEKTAH MTIEKGRESLAREISQAANDQLKDFGIVVVDVIFKGIKYSDELQASVFNRMVKERNQIAQ MFRSTGEGKKAEWLGKLDNEKRSLLSKAYEEAERIKGEADARAAAVYAQSYGKSPEFYGF WKSLEVYKKSLPDTEKILSTDLEYFKHLYQH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hflC |
Synonyms | hflC; TP_0114; Protein HflC |
UniProt ID | O83152 |
◆ Recombinant Proteins | ||
FAM83F-4647HF | Recombinant Full Length Human FAM83F Protein, GST-tagged | +Inquiry |
SSP-RS12055-0135S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS12055 protein, His-tagged | +Inquiry |
AYP1020-RS05695-6013S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS05695 protein, His-tagged | +Inquiry |
NTAN1-1384H | Recombinant Human NTAN1, GST-tagged | +Inquiry |
LRRC16A-9250M | Recombinant Mouse LRRC16A Protein | +Inquiry |
◆ Native Proteins | ||
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
EPHX4-6583HCL | Recombinant Human EPHX4 293 Cell Lysate | +Inquiry |
TRAF2-824HCL | Recombinant Human TRAF2 293 Cell Lysate | +Inquiry |
CD55-2531HCL | Recombinant Human CD55 cell lysate | +Inquiry |
Testis-677H | Hamster Testis Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hflC Products
Required fields are marked with *
My Review for All hflC Products
Required fields are marked with *
0
Inquiry Basket