Recombinant Full Length Bifidobacterium Adolescentis Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL8391BF |
Product Overview : | Recombinant Full Length Bifidobacterium adolescentis Undecaprenyl-diphosphatase(uppP) Protein (A1A1M3) (1-294aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bifidobacterium adolescentis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-294) |
Form : | Lyophilized powder |
AA Sequence : | MNFFQAIFLGLVQALTEYLPVSSSAHIRIIGDLMLGSDPGAAFTAIIQIGTELAVILYFR HDIIRILGAWFGSLFGKEGKDFKSRMGAHNRDTQMGWFIIIGTLPILIAGLLFKDAIEST LRNLWITVTVLIIFGILLWVVDARAKQVKTMDEMTWKDALIFGIGQMLALIPGVSRSGGT ITFGRAMGYTREAAVRVSFLMAIPAVFGAGILEAVSAVKDVAAGNAGMFPGWGATIAATI VAFVVGYVVIIGFLKFVSTFSYKAFAIYRIALAVVVALLLICGVLHPTEVVAAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; bacA; BAD_0825; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | A1A1M3 |
◆ Recombinant Proteins | ||
ARSH-866H | Recombinant Human ARSH protein, GST-tagged | +Inquiry |
CTSH-1889H | Recombinant Human CTSH Protein (Ala23-Val335), N-His tagged | +Inquiry |
HMBOX1A-3344Z | Recombinant Zebrafish HMBOX1A | +Inquiry |
NGB-9358Z | Recombinant Zebrafish NGB | +Inquiry |
CCL8-302H | Active Recombinant Human Chemokine (C-C Motif) Ligand 8, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Native Proteins | ||
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLEKHB2-3113HCL | Recombinant Human PLEKHB2 293 Cell Lysate | +Inquiry |
KIF22-927HCL | Recombinant Human KIF22 cell lysate | +Inquiry |
PEX14-1336HCL | Recombinant Human PEX14 cell lysate | +Inquiry |
FUBP3-675HCL | Recombinant Human FUBP3 cell lysate | +Inquiry |
DDX54-460HCL | Recombinant Human DDX54 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket