Recombinant Full Length Hyphomonas Neptunium Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL13312HF |
Product Overview : | Recombinant Full Length Hyphomonas neptunium Undecaprenyl-diphosphatase(uppP) Protein (Q0C618) (1-285aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hyphomonas neptunium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-285) |
Form : | Lyophilized powder |
AA Sequence : | MSILQLVLIALMQGITEWLPISSSAHVMLVSDVVGLAGRDELLINAASNAGTLLAMLLYF RKDVAAAIAGGFELLGAPVTRKPLSAGGRLALCILVATPFALAGAVIYENFIPENIWTAL RSVYAVAASTIVFGALLWWADARGGQSRSEGDMTLRDAFLIGASQLVAVIIPGTSRSGIT MTAARALGYERVEAARFSMLIGAPILAAVSLYGLLGLATTPADGMGASLTDGLIVAALAF VSGYASIGLLMALLRKMSFLPFVLYRFALGIALLATSPIVAGAMG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; HNE_0091; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q0C618 |
◆ Recombinant Proteins | ||
G6PD-1605R | Recombinant Rhesus Macaque G6PD Protein, His (Fc)-Avi-tagged | +Inquiry |
HIF1A-3092H | Recombinant Human HIF1A, His tagged | +Inquiry |
KEAP1-593HF | Recombinant Full Length Human KEAP1 Protein, GST-tagged | +Inquiry |
RFL13697BF | Recombinant Full Length Buchnera Aphidicola Subsp. Acyrthosiphon Pisum Electron Transport Complex Protein Rnfe(Rnfe) Protein, His-Tagged | +Inquiry |
AMPK(A1/B2/G1)-244H | Recombinant Human AMPK (A1/B2/G1), His-tagged, Active | +Inquiry |
◆ Native Proteins | ||
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM1A-001HCL | Recombinant Human KDM1A cell lysate | +Inquiry |
RAB11B-2630HCL | Recombinant Human RAB11B 293 Cell Lysate | +Inquiry |
FGFR4-1907HCL | Recombinant Human FGFR4 cell lysate | +Inquiry |
OGDH-454HCL | Recombinant Human OGDH lysate | +Inquiry |
TNFRSF25-2154HCL | Recombinant Human TNFRSF25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket