Recombinant Full Length Bdellovibrio Phage Phimh2K Uncharacterized Protein N(Orfn) Protein, His-Tagged
Cat.No. : | RFL3800BF |
Product Overview : | Recombinant Full Length Bdellovibrio phage phiMH2K Uncharacterized protein N(ORFN) Protein (Q9G049) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bdellovibrio phage phiMH2K (Bacteriophage phiMH2K) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | METKPNALTGTSLSSTSGQTTQKSITLQNSENKYIPQNSSETFGLMAILNLALLLWTLLA TLRVTLQKNWPTETTKTTTITQFTTLQKNTPSAKNGLKNTTNKHSHEDM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORFN |
Synonyms | ORFN; Uncharacterized protein N |
UniProt ID | Q9G049 |
◆ Recombinant Proteins | ||
HSD3B2-6675C | Recombinant Chicken HSD3B2 | +Inquiry |
GABRG2-6897C | Recombinant Chicken GABRG2 | +Inquiry |
RFL963SF | Recombinant Full Length Sargocentron Punctatissimum Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
Magi2-3905M | Recombinant Mouse Magi2 Protein, Myc/DDK-tagged | +Inquiry |
LTV1-9356M | Recombinant Mouse LTV1 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBBP9-2488HCL | Recombinant Human RBBP9 293 Cell Lysate | +Inquiry |
ITGAV-877HCL | Recombinant Human ITGAV cell lysate | +Inquiry |
COQ5-7347HCL | Recombinant Human COQ5 293 Cell Lysate | +Inquiry |
IL12A & IL12B-1782MCL | Recombinant Mouse IL12A & IL12B Overexpression Lysate(Met 1-Ala 215&Met 1-Ser 335) | +Inquiry |
LAIR1-1331MCL | Recombinant Mouse LAIR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORFN Products
Required fields are marked with *
My Review for All ORFN Products
Required fields are marked with *
0
Inquiry Basket