Recombinant Full Length Bacillus Subtilis Uncharacterized Transporter Ywrb(Ywrb) Protein, His-Tagged
Cat.No. : | RFL25113BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized transporter YwrB(ywrB) Protein (O05216) (1-197aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-197) |
Form : | Lyophilized powder |
AA Sequence : | MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGP IATKMAAYLGFKLKGTLGAIVAILAHILPTCLAMVGLFAAVNVLSHSAIVAGMIGAVTPV IAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKL KDKITNKHSKDKGMSAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ywrB |
Synonyms | ywrB; BSU36120; Uncharacterized transporter YwrB |
UniProt ID | O05216 |
◆ Native Proteins | ||
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDLIM2-3326HCL | Recombinant Human PDLIM2 293 Cell Lysate | +Inquiry |
ACYP1-9042HCL | Recombinant Human ACYP1 293 Cell Lysate | +Inquiry |
ZNF343-2015HCL | Recombinant Human ZNF343 cell lysate | +Inquiry |
ROPN1B-1533HCL | Recombinant Human ROPN1B cell lysate | +Inquiry |
GPR32-5787HCL | Recombinant Human GPR32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ywrB Products
Required fields are marked with *
My Review for All ywrB Products
Required fields are marked with *
0
Inquiry Basket