Recombinant Full Length Bacillus Subtilis Uncharacterized Transporter Ywcj(Ywcj) Protein, His-Tagged
Cat.No. : | RFL28636BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized transporter YwcJ(ywcJ) Protein (P39608) (1-256aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-256) |
Form : | Lyophilized powder |
AA Sequence : | METQALQKVEQYALKKQNIFASSKIRYVLRSILASIFIGFGITAASKTGSYFFMADSPFAFPAAAVTFGAAILMIAYGGGDLFTGNTFYFTYTALRKKISWRDTLYLWMSSYAGNLIGAILFAILISATGLFEEPSVHSFLIHLAEHKMEPPASELFFRGMLCNWLVCLAFFIPMSLKGEGAKLFTMMLFVFCFFISGFEHSIANMCTFAISLLIEHPDTVTLMGAVRNLIPVTLGNLTAGIVMMGWMYYTLNPDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ywcJ |
Synonyms | ywcJ; BSU38060; ipa-48r; Uncharacterized transporter YwcJ |
UniProt ID | P39608 |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM30-9035HCL | Recombinant Human ADAM30 293 Cell Lysate | +Inquiry |
TTC8-673HCL | Recombinant Human TTC8 293 Cell Lysate | +Inquiry |
STARD3NL-639HCL | Recombinant Human STARD3NL lysate | +Inquiry |
AOC3-85HCL | Recombinant Human AOC3 cell lysate | +Inquiry |
MARCH2-4472HCL | Recombinant Human MARCH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ywcJ Products
Required fields are marked with *
My Review for All ywcJ Products
Required fields are marked with *
0
Inquiry Basket