Recombinant Full Length Synechocystis Sp. Uncharacterized Protein Slr0964 (Slr0964) Protein, His-Tagged
Cat.No. : | RFL23552SF |
Product Overview : | Recombinant Full Length Synechocystis sp. Uncharacterized protein slr0964 (slr0964) Protein (P72855) (1-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-308) |
Form : | Lyophilized powder |
AA Sequence : | MDFASGLPIFIVTLREALEASLVVGIVLACLARAQQMQLKGWVYRGISAGVVASVLVGCL LAGVLQGVERLPGPYTPILKALLAALLGAIAVGMLSWMLLWMTKQARSLRGEIQGQINQA VEKEGGGKAIAIVVFIAVVREGFEMVLFLAAQQNMANPAAIGAALAGIGTAVVMAFLIFR LGVKLNLKLFFQVMGTLLLIIVGGLVIGVLKNLDLAVSMMGLANLGLGYLCFVPGDSCLL GPLLWNLAPWLPDNQFPGIVLKTLAGYRDHLYLFQAIAYGIFLSVIGSLYFRGLAGKGDA PQAVAQKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slr0964 |
Synonyms | slr0964; Uncharacterized protein slr0964 |
UniProt ID | P72855 |
◆ Recombinant Proteins | ||
RAB3IP-260H | Recombinant Human RAB3IP Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HHIP-7612M | Recombinant Mouse HHIP Protein | +Inquiry |
RFL30738BF | Recombinant Full Length Bovine Thromboxane A2 Receptor(Tbxa2R) Protein, His-Tagged | +Inquiry |
C3orf58-1825H | Recombinant Human C3orf58 Protein, His-tagged | +Inquiry |
ACSF2-124R | Recombinant Rat ACSF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTG1-9064HCL | Recombinant Human ACTG1 293 Cell Lysate | +Inquiry |
TSPAN4-707HCL | Recombinant Human TSPAN4 293 Cell Lysate | +Inquiry |
ZNF501-62HCL | Recombinant Human ZNF501 293 Cell Lysate | +Inquiry |
Pancreas-567M | MiniPig Pancreas Lysate, Total Protein | +Inquiry |
MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slr0964 Products
Required fields are marked with *
My Review for All slr0964 Products
Required fields are marked with *
0
Inquiry Basket