Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Ybff(Ybff) Protein, His-Tagged
Cat.No. : | RFL17152BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein ybfF(ybfF) Protein (O31446) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHYYSEPSLPLQFLVKVA VLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIFMTYTKIIKKGNKNKGK ASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNEDSMNFSAVLNHVLTISKN DKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSIIVVYATSLFSGQINYIDI PHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRAEYLRMRGVIDFILTERYNK KIM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybfF |
Synonyms | ybfF; BSU02190; Uncharacterized protein YbfF |
UniProt ID | O31446 |
◆ Recombinant Proteins | ||
GHR-548R | Recombinant Rat Ghr, Fc tagged | +Inquiry |
RPS3A-6830H | Recombinant Human Ribosomal Protein S3A, His-tagged | +Inquiry |
GM216-3686M | Recombinant Mouse GM216 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIF-3552M | Recombinant Mouse GIF Protein, His (Fc)-Avi-tagged | +Inquiry |
SAOUHSC-00552-4649S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00552 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2-647P | Native Pig F2 | +Inquiry |
ECGS-32B | Native Bovine ECGS | +Inquiry |
UMOD-91P | Native Porcine UMOD | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIDD1-4657HCL | Recombinant Human LRDD 293 Cell Lysate | +Inquiry |
CCS-312HCL | Recombinant Human CCS cell lysate | +Inquiry |
SERPINB12-646MCL | Recombinant Mouse SERPINB12 cell lysate | +Inquiry |
S100A4-001MCL | Recombinant Mouse S100A4 cell lysate | +Inquiry |
POLA2-3054HCL | Recombinant Human POLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybfF Products
Required fields are marked with *
My Review for All ybfF Products
Required fields are marked with *
0
Inquiry Basket