Recombinant Full Length Bacillus Subtilis Sensor Histidine Kinase Glnk(Glnk) Protein, His-Tagged
Cat.No. : | RFL11793BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Sensor histidine kinase glnK(glnK) Protein (P40758) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-410) |
Form : | Lyophilized powder |
AA Sequence : | MLITVPLAGELKFYPLNEEFRVSFGAPVFFFFLSLLRHVPAVLPGFLTGAAVFIFRVFLE LWGGGHNGLTPILYDQASGFFFYMTYACLFSILKANRFRERPIMLGFIGFMIEVVSDCVE LTVQFLIFHTVVTPEKITDIAVIAISHTFIVMSFYSVLKLYETQSREKQTRQQHEHMLMI VSNLYEETVHLKKTLKTTEKVTNDSYQLYREMKGKDVQLSGRILRLAGEIHEVKKDNQRI FAGLSKLISNESLRDYMRASDLLQLVIRMNEKYAEALGKQIDFYCSIEGEHDEYHVFIVL SIINNLTANAVEAMDEEGMVSLRLRKPNESMVEFQVEDNGPGISEKIGDIVFDPGFTSKY DEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRGVVFAIRLPVRHLIQKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glnK |
Synonyms | glnK; nrgB; ycbA; yzgA; BSU02440; Sensor histidine kinase GlnK |
UniProt ID | P40758 |
◆ Recombinant Proteins | ||
APOBEC3A_B-2485H | Recombinant Human APOBEC3A_B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL3629HF | Recombinant Full Length Helianthus Annuus Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged | +Inquiry |
TK1-8093H | Recombinant Human TK1 protein, His & GST-tagged | +Inquiry |
FAS-2183C | Active Recombinant Cynomolgus FAS protein, hFc-tagged | +Inquiry |
CDC42EP1-3102HF | Recombinant Full Length Human CDC42EP1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
GAPDH-62H | Native Human Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
Thrombin-22H | Active Native Human Thrombin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOC378125-4693HCL | Recombinant Human LOC378125 293 Cell Lysate | +Inquiry |
Penis-380R | Rhesus monkey Penis Lysate | +Inquiry |
CCDC67-160HCL | Recombinant Human CCDC67 lysate | +Inquiry |
GCH1-5988HCL | Recombinant Human GCH1 293 Cell Lysate | +Inquiry |
DHODH-6944HCL | Recombinant Human DHODH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glnK Products
Required fields are marked with *
My Review for All glnK Products
Required fields are marked with *
0
Inquiry Basket