Recombinant Full Length Bacillus Subtilis Rhomboid Protease Glup(Glup) Protein, His-Tagged
Cat.No. : | RFL5839BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Rhomboid protease gluP(gluP) Protein (P54493) (1-507aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-507) |
Form : | Lyophilized powder |
AA Sequence : | MFLLEYTYWKIAAHLVNSGYGVIQAGESDEIWLEAPDKSSHDLVRLYKHDLDFRQEMVRD IEEQAERVERVRHQLGRRRMKLLNVFFSTEAPVDDWEEIAKKTFEKGTVSVEPAIVRGTM LRDDLQAVFPSFRTEDCSEEHASFENAQMARERFLSLVLKQEEQRKTEAAVFQNGKPTFT YLFIALQILMFFLLEINGGSTNTETLVAFGAKENSLIAQGEWWRLLTPIVLHIGIAHLAF NTLALWSVGTAVERMYGSGRFLLIYLAAGITGSIASFVFSPYPSAGASGAIFGCLGALLY VALSNRKMFLRTIGTNIIVIIIINLGFGFAVSNIDNSGHIGGLIGGFFAAAALGLPKAGA FGKRLLSAVLLIALAVGFLYYGLHSPSHQESALIQQASELYQEGKYEEVTELLNGEAAQK DASADLLKILAVSDIQIGEYDQAVSLLERAVKKEPKDHASYYNLALLYAEKNELAQAEKA IQTAVKLKPKEQRYKELQRQIENNKES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gluP |
Synonyms | gluP; yqgP; BSU24870; Rhomboid protease GluP; Intramembrane serine protease |
UniProt ID | P54493 |
◆ Recombinant Proteins | ||
IFNLR1-0215H | Recombinant Human IFNLR1 protein, His-tagged | +Inquiry |
MSMB-5661H | Recombinant Human MSMB Protein, GST-tagged | +Inquiry |
RNF8-3765R | Recombinant Rhesus Macaque RNF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL5-1397M | Recombinant Mouse CCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
bsk-2271F | Recombinant Fruit fly bsk protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C3b-47H | Native Human Complement C3b | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST2H2AC-330HCL | Recombinant Human HIST2H2AC lysate | +Inquiry |
LETMD1-4771HCL | Recombinant Human LETMD1 293 Cell Lysate | +Inquiry |
TEAD3-1154HCL | Recombinant Human TEAD3 293 Cell Lysate | +Inquiry |
PNMT-3075HCL | Recombinant Human PNMT 293 Cell Lysate | +Inquiry |
TTC9C-672HCL | Recombinant Human TTC9C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gluP Products
Required fields are marked with *
My Review for All gluP Products
Required fields are marked with *
0
Inquiry Basket