Recombinant Full Length Bacillus Subtilis Probable Abc Transporter Permease Protein Yqgi(Yqgi) Protein, His-Tagged
Cat.No. : | RFL31011BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Probable ABC transporter permease protein yqgI(yqgI) Protein (P46340) (1-294aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-294) |
Form : | Lyophilized powder |
AA Sequence : | MNRKITDKLATGMFGLCAAIIAAILVGLFSYIIINGVSQLSFQFITTKSSAIAAGGGIRD QLFNSFYILFITMLITIPLGVGGGVFMAEYAPNNKVTDFIRTCIEVLSSLPSIVIGMFGL LMFVNLTGWGYTIIGGALALTVFNLPVMVRVTEDAIRSVPKDLKEASLALGVSRWHTVKT VLIPSAIPSIITGAILASGRVFGEAAALLFTAGLTTPRLNFTEWNPFSETSPLNIFRPAE TLAVHIWNVNTQGMIPDAEAIANGGSAVLVISVLVFNLAARWLGTMIYKKLTAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yqgI |
Synonyms | yqgI; yzmD; BSU24970; Probable ABC transporter permease protein YqgI |
UniProt ID | P46340 |
◆ Recombinant Proteins | ||
CNGA2-1556H | Recombinant Human CNGA2 Protein, GST-tagged | +Inquiry |
Psmd6-5197M | Recombinant Mouse Psmd6 Protein, Myc/DDK-tagged | +Inquiry |
SLC34A2-8328M | Recombinant Mouse SLC34A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxcl1-7216M | Recombinant Mouse Cxcl1 Protein, His-tagged | +Inquiry |
PCNA-1534Y | Recombinant Yeast PCNA protein | +Inquiry |
◆ Native Proteins | ||
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
CVB1-12 | Native Coxsackievirus B1 Antigen | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-524C | Cynomolgus monkey Thymus Lysate | +Inquiry |
CDC25B-7665HCL | Recombinant Human CDC25B 293 Cell Lysate | +Inquiry |
MAGEB1-4548HCL | Recombinant Human MAGEB1 293 Cell Lysate | +Inquiry |
DDX39A-7008HCL | Recombinant Human DDX39 293 Cell Lysate | +Inquiry |
EPHB3-2131MCL | Recombinant Mouse EPHB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yqgI Products
Required fields are marked with *
My Review for All yqgI Products
Required fields are marked with *
0
Inquiry Basket