Recombinant Full Length Bacillus Subtilis Magnesium Transporter Mgte(Mgte) Protein, His-Tagged
Cat.No. : | RFL32860BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Magnesium transporter mgtE(mgtE) Protein (O34442) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MVQNMTYDELILRIIILLRDGKIRDFRSVIDELQPYDMAFIFKEMPEKHRARYLSYLTVD DITDMIGELEREFQLVVLNKVGKTKATLAMNKMDNDDLAQLLEEMDEELKEQLLSSMEAS ESKAVQLLMNYPADSAGRMMTNRYVWIPQHYTVKDAVVKLKSFAEIAESINYLYVINESK QLVGVLSYRDLILGEPEEKVQDLMFTRVISADALQDQEEVARLIERYDFLAIPVVEENNV LVGIVTVDDIIDVVIREADEDYEKFAASGKDITFDTKAYVAAYRRLPWLILLLFIGLISG SIISYFEDALKQVVALAFFMPMVSGMTGNTGTQSLAVVIRGLSKEEMNKKTIVRLIFREF RTSIFIGAVCSVLIAIVSIIWQGNALLGFVVASSLFLTLIIGTMSGTIIPIILHKLKVDP AIASGPLITTLNDILSLLIYFGIATAFIHSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mgtE |
Synonyms | mgtE; ykoK; BSU13300; Magnesium transporter MgtE |
UniProt ID | O34442 |
◆ Recombinant Proteins | ||
VCAN-6350C | Recombinant Chicken VCAN | +Inquiry |
RFL36909DF | Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 67B(Or67B) Protein, His-Tagged | +Inquiry |
Spike-1298V | Recombinant COVID-19 Spike RBD (P479L) protein(Arg319-Phe541), His-tagged | +Inquiry |
RNF112-3994H | Recombinant Human RNF112 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDAC10-2815R | Recombinant Rat HDAC10 Protein | +Inquiry |
◆ Native Proteins | ||
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Fxa-281B | Active Native Bovine Factor Xa | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALB-8923HCL | Recombinant Human ALB 293 Cell Lysate | +Inquiry |
TULP1-712HCL | Recombinant Human TULP1 lysate | +Inquiry |
C9orf9-7920HCL | Recombinant Human C9orf9 293 Cell Lysate | +Inquiry |
IDO2-5299HCL | Recombinant Human IDO2 293 Cell Lysate | +Inquiry |
LRRTM1-4617HCL | Recombinant Human LRRTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mgtE Products
Required fields are marked with *
My Review for All mgtE Products
Required fields are marked with *
0
Inquiry Basket