Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 67B(Or67B) Protein, His-Tagged
Cat.No. : | RFL36909DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 67b(Or67b) Protein (Q9VT20) (1-421aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-421) |
Form : | Lyophilized powder |
AA Sequence : | MQDQLDHELERIDKLPKLGLLWVEYSAYALGVNIAPRKRSSKYCRLTRILVLIVNLSIIY SLVAFIMENYMISFETYVEAVLLTFQLSVGVVKMFHFQNKVESCSQLVFSTETGEVLKSL GLFQLDLPRKKELLSSVSLILLNNWMIIDRQVMFFFKIVCMPVLYYCVRPYFQYIFDCYI KDKDTCEMTLTYPAIVPYLQLGNYEFPSYVIRFFLLQSGPLWCFFAVFGFNSLFVVLTRY ESGLIKVLRFLVQNSTSDILVPKDQRVKYLQCCVRLFARISSHHNQIENLFKYIILVQCS VSSILICMLLYKISTVLEVGWVWMGMIMVYFVTIALEITLYNVSAQKVESQSELLFHDWY NCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTSLSHKFLVQVFRLSANFFLLLRNMNN K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or67b |
Synonyms | Or67b; CG14176; Odorant receptor 67b |
UniProt ID | Q9VT20 |
◆ Recombinant Proteins | ||
OMA1-6837HF | Recombinant Full Length Human OMA1 Protein, GST-tagged | +Inquiry |
Col1a1-5382R | Recombinant Rat Col1a1 protein, His-tagged | +Inquiry |
SOX2-1379H | Recombinant Human SOX2 protein, His-tagged | +Inquiry |
FGFR3-779HAF488 | Recombinant Human FGFR3 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
AYP1-1051H | Recombinant Human AYP1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
CA9-1447CCL | Recombinant Canine CA9 cell lysate | +Inquiry |
STK4-604HCL | Recombinant Human STK4 cell lysate | +Inquiry |
Heart-211B | Bovine Heart Lysate | +Inquiry |
WDR61-339HCL | Recombinant Human WDR61 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or67b Products
Required fields are marked with *
My Review for All Or67b Products
Required fields are marked with *
0
Inquiry Basket