Recombinant Full Length Bacillus Subtilis Cell Division Topological Determinant Minj(Minj) Protein, His-Tagged
Cat.No. : | RFL27280BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Cell division topological determinant MinJ(minJ) Protein (O34375) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MSVQWGIELLKSAGLFFLHPLFWFFIIITLAFGYVRIKRERKTFHTRIADIYDDLKFTYT KGLIPGLLLSVILGGLGISIPLGLLAIIAVITAAAAFTLRANWMSAAYIVSVSMLIGFGL QIYQAEPFLERFPQGFAVVWPAVAVFLGLLIITEGAVAYRSAHVRTSPALVVSSRGLPIG QQLANRVWLLPLFLLVPGNGLESHLSWWPVFTVPGGSFHFLWIPYFVGFGQRVQGSLPET SIRITAKRVCILGLAVAVLGAASLLWTPLAGAAVCTALLGRIFLSIKQRVNDNAAPFYFS KRDQGLMVLGIIPNTPAEDLELKIGEIITKVNGIPVKNVSDFYEALQHNRAYVKLEIIGL NGEIRFDQRASYEGEHHELGILFVKDDREDEAVASGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | minJ |
Synonyms | minJ; swrAB; yvjD; BSU35220; Cell division topological determinant MinJ |
UniProt ID | O34375 |
◆ Recombinant Proteins | ||
Spike-305V | Recombinant COVID-19 Spike RBD (A522V) protein, His-tagged | +Inquiry |
THIL-0760B | Recombinant Bacillus subtilis THIL protein, His-tagged | +Inquiry |
TNFSF13-142H | Recombinant Human TNFSF13 Protein, DYKDDDDK-tagged | +Inquiry |
PGR-1182D | Recombinant Dog PGR Protein, His&GST-tagged | +Inquiry |
cas9-12 | Recombinant Cas9 Nuclease Protein | +Inquiry |
◆ Native Proteins | ||
DAO1-25P | Active Native Porcine D-Amino acid oxidase | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR1D-3040HCL | Recombinant Human POLR1D 293 Cell Lysate | +Inquiry |
RNASE2-1514HCL | Recombinant Human RNASE2 cell lysate | +Inquiry |
SH3GL2-1867HCL | Recombinant Human SH3GL2 293 Cell Lysate | +Inquiry |
KCNJ13-5048HCL | Recombinant Human KCNJ13 293 Cell Lysate | +Inquiry |
IGSF8-977HCL | Recombinant Human IGSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All minJ Products
Required fields are marked with *
My Review for All minJ Products
Required fields are marked with *
0
Inquiry Basket