Recombinant Full Length Bacillus Pumilus Upf0754 Membrane Protein Bpum_0927 (Bpum_0927) Protein, His-Tagged
Cat.No. : | RFL31789BF |
Product Overview : | Recombinant Full Length Bacillus pumilus UPF0754 membrane protein BPUM_0927 (BPUM_0927) Protein (A8FBJ4) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Pumilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MNIFTTFLFMIVIGAVIGAATNHLAIKMLFRPYKPYYLFGKQLPFTPGLIPKRRDEVAKQ VGVLVMEHLLTPEGIQKRFESSEAKQEILHTVHRLIDKGADMEITVLSLLERFGVSHADV KADEWLHHWSDRKLASLLKKYNEQTLSELLPLEVENKISSKIPDAADYILKRGIHYFESE EGKARLGNMIDDFLKERGMLGGMVQMFLGNSSLIDRVHPEIIKFLRNAETKKFLTDLLVQ EWEKVKQFSLQELDDKWNVKELAYSVKKQLLSHFSTKVILDKPVGSYVSEVAVDLKIYLA PVLVDKGIKAASNALEGLLAKLKFEDIIREQIELFPLKKMEELVISISNNELKMITFLGG FLGGLIGAIQAIFVTLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BPUM_0927 |
Synonyms | BPUM_0927; UPF0754 membrane protein BPUM_0927 |
UniProt ID | A8FBJ4 |
◆ Recombinant Proteins | ||
RFL2797GF | Recombinant Full Length Gluconobacter Oxydans Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
CETN2-1607M | Recombinant Mouse CETN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM5-665HAF488 | Recombinant Human CEACAM5 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
ZNF512-10435M | Recombinant Mouse ZNF512 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP6-5589H | Recombinant Human Charged Multivesicular Body Protein 6, His-tagged | +Inquiry |
◆ Native Proteins | ||
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIMP1-578HCL | Recombinant Human AIMP1 lysate | +Inquiry |
TMED3-1024HCL | Recombinant Human TMED3 293 Cell Lysate | +Inquiry |
CEACAM1-2214MCL | Recombinant Mouse CEACAM1 cell lysate | +Inquiry |
YES1-620HCL | Recombinant Human YES1 cell lysate | +Inquiry |
HIST1H4G-5523HCL | Recombinant Human HIST1H4G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BPUM_0927 Products
Required fields are marked with *
My Review for All BPUM_0927 Products
Required fields are marked with *
0
Inquiry Basket