Recombinant Full Length Bacillus Cereus Upf0754 Membrane Protein Bcb4264_A0915 (Bcb4264_A0915) Protein, His-Tagged
Cat.No. : | RFL8949BF |
Product Overview : | Recombinant Full Length Bacillus cereus UPF0754 membrane protein BCB4264_A0915 (BCB4264_A0915) Protein (B7HEV2) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MNIWLNMLTTTGLGAIIGGYTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRYMLEKWNVAHVEE EATRKIEYVITEKIHAFLAEYYTYTWEQALPHSVHEKIENAIPNASAFILERGISFFESE EGKARLSKMIDDFFASRGTLLNLVGMFLGNVSVVDRVQPEVIKFLGQDATKQLLTDVLQK EWEKLKGRDVKELEAFVEKEMIVSSVLSAVKVEETVSKFLNQSVQQVCEPVRETIIEKVV PSAVAKGLKWGTENVESILNNLHLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGMIGLVQGLLLLFLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCB4264_A0915 |
Synonyms | BCB4264_A0915; UPF0754 membrane protein BCB4264_A0915 |
UniProt ID | B7HEV2 |
◆ Recombinant Proteins | ||
FTL-9299HFL | Recombinant Full Length Human FTL protein, Flag-tagged | +Inquiry |
TRIM66-4158Z | Recombinant Zebrafish TRIM66 | +Inquiry |
QKI-11H | Recombinant Human DFFB Protein(11-290aa), His-tagged | +Inquiry |
VKORC1L1-3664H | Recombinant Human VKORC1L1, GST-tagged | +Inquiry |
RFL28678VF | Recombinant Full Length Vibrio Harveyi Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
PLE-105P | Active Native Porcine Esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXorf40B-210HCL | Recombinant Human CXorf40B lysate | +Inquiry |
BAI3-8523HCL | Recombinant Human BAI3 293 Cell Lysate | +Inquiry |
UBE2H-576HCL | Recombinant Human UBE2H 293 Cell Lysate | +Inquiry |
HCT-116-031HCL | Human HCT-116 Cell Nuclear Extract | +Inquiry |
COASY-7387HCL | Recombinant Human COASY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCB4264_A0915 Products
Required fields are marked with *
My Review for All BCB4264_A0915 Products
Required fields are marked with *
0
Inquiry Basket