Recombinant Full Length Azotobacter Vinelandii Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL33033AF |
Product Overview : | Recombinant Full Length Azotobacter vinelandii Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (C1DHS4) (1-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Azotobacter Vinelandii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-537) |
Form : | Lyophilized powder |
AA Sequence : | MKLLAVRRLLRIQSVVVRYRLDDLLFDQPLLPWWLRALGYLLPWRWLPRRRSEQPRAVRL RLALQDLGPIFIKFGQILSTRRDLLPEDIADELTWLQDRVPPFNPQQSVALIEEQLGARV DEAFARFDSEPLASASVAQVHAAQLKTGEEVVVKVVRPGLKAVIRQDLAWLYLFARLAER ASTEARRLHLVDVVSDYEKTIYDELDLLREAANASQLKRNFEGSPLLYVPQIYWDWCRPK VLVMERIYGVPVTDLAALVDQGTDLKLLAERGVEIFFTQVFRDSFFHADMHPGNIFVSTR QPWDPQYIAIDCGIVGSLTPQDQDYLARNLLAFFKRDYRKVAQLHIDSGWVPADTQVNEF EAAIRTVCEPIFEKPLKDISFGQLLLRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQL YPELDLWTTAKPFLERWMRKRMSPKAMLDNLQGQLEQLPHLAQMTRTALEDISRPAWDTR KRERHDHHLLRLLGAALLAGGVLLALQTPPTSANAWPSWLMLASGLYLLVGRRRLSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; Avin_45430; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | C1DHS4 |
◆ Recombinant Proteins | ||
SH-RS07980-5795S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS07980 protein, His-tagged | +Inquiry |
ARRDC1-AS1-0198H | Recombinant Human ARRDC1-AS1 Protein, GST-Tagged | +Inquiry |
LCAT-1013H | Recombinant Human LCAT, Flag-tagged | +Inquiry |
CDRT15-3168H | Recombinant Human CDRT15 Protein, MYC/DDK-tagged | +Inquiry |
DCTD-732H | Recombinant Human dCMP Deaminase, His-tagged | +Inquiry |
◆ Native Proteins | ||
TNC-50H | Native Human Tenascin C | +Inquiry |
Tyrosinase-39 | Native Tyrosinase, Enzyme Activity | +Inquiry |
C9-58H | Native Human Complement C9 | +Inquiry |
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMR-32-2150H | IMR-32 (human neuroblastoma) whole cell lysate | +Inquiry |
Hela-02HL | HeLa Whole Cell Lysate | +Inquiry |
GPR171-305HCL | Recombinant Human GPR171 lysate | +Inquiry |
HIST1H3F-5530HCL | Recombinant Human HIST1H3F 293 Cell Lysate | +Inquiry |
ZNF230-113HCL | Recombinant Human ZNF230 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket