Recombinant Full Length Pseudomonas Entomophila Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL21464PF |
Product Overview : | Recombinant Full Length Pseudomonas entomophila Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (Q1I3S8) (1-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas entomophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-537) |
Form : | Lyophilized powder |
AA Sequence : | MKLLAVRRLLRIQRVVIRYRLDDLLFEQPLLPWWLASLRLLMPWRWLPRKPLALSRGARL RLALQDLGPIFIKFGQLLSTRRDLLPTDIADELMLLQDRVPPFDPQHAVALIEEQLGAKV GEVFSRFDVEPLASASVAQVHAARLKSGEEVVVKVVRPGLKPVIAQDLAWLFLIAKAAER ASADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEGSELMYVPQVYWDLCRPK VLVMERIYGVPVTDMATLADQRTDMKMLAERGVEVFFTQVFRDSFFHADMHPGNIFVSTV KPWSPQYIAIDCGIVGSLTAEDQDYLARNLIAFFKRDYRRVAQLHIDSGWVPAQTKVNEF EAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQL YPDLDLWSTAKPFLERWMRERMSPKAVIGNLYNQAEQLPHLADMTRDLLERLSQPHLNDA QLPERRRQGDNWALRLLGAGLLGGGATLAAGAVSLSAPAAWPAWLMLAAGLYLIVRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; PSEEN5075; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | Q1I3S8 |
◆ Recombinant Proteins | ||
NOTCH2-721HB | Recombinant Human NOTCH2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
MEST-8671Z | Recombinant Zebrafish MEST | +Inquiry |
ZC3H12D-3793H | Recombinant Human ZC3H12D protein, His-tagged | +Inquiry |
EFCAB5-5015M | Recombinant Mouse EFCAB5 Protein | +Inquiry |
UBA5-1958H | Recombinant Human Ubiquitin-Like Modifier Activating Enzyme 5, His-tagged | +Inquiry |
◆ Native Proteins | ||
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
IgG-353C | Native Chicken IgG | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBXN2B-538HCL | Recombinant Human UBXN2B 293 Cell Lysate | +Inquiry |
G6PC2-6081HCL | Recombinant Human G6PC2 293 Cell Lysate | +Inquiry |
KRTAP19-5-4848HCL | Recombinant Human KRTAP19 293 Cell Lysate | +Inquiry |
AVPR1A-152HCL | Recombinant Human AVPR1A cell lysate | +Inquiry |
TC2N-1195HCL | Recombinant Human TC2N 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket