Recombinant Full Length Psilotum Nudum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL33860PF |
Product Overview : | Recombinant Full Length Psilotum nudum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q8WHZ6) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psilotum nudum (Whisk fern) (Lycopodium nudum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRIGITKSWGGWSITGDTVSDAGIWSFEGVAAAHITLSGLLFLSAIWHWVYWDL DLFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHITGLFGPGIWISDPYGLTGKVQP VDPAWGAEGFDPFIPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFVVSGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRIRASRAEGLSLSE AWSRIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAIGWLGHAAFKDKEGHELFVRRMP TFFETFPVVLVDEEGIVRADAPFRRAESKYSVEQVGVTVEFYGGELNGVGFNDPSTVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALIFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTERQGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q8WHZ6 |
◆ Recombinant Proteins | ||
RSPO1-053H | Active Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
PYGO2-1932H | Recombinant Human PYGO2 protein, His & GST-tagged | +Inquiry |
cea-4184E | Recombinant Escherichia coli cea protein, His&Myc-tagged | +Inquiry |
SCYL3-0649H | Recombinant Human SCYL3 Protein (G2-W742), His/GST tagged | +Inquiry |
HTRA1-2578M | Recombinant Mouse HTRA1 Protein (141-480 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
ASO-153H | Active Native Human Antistreptolysin O | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMP2-6606HCL | Recombinant Human EMP2 293 Cell Lysate | +Inquiry |
Cerebellum-66R | Rhesus monkey Cerebellum (RT) Lysate | +Inquiry |
ACN9-9092HCL | Recombinant Human ACN9 293 Cell Lysate | +Inquiry |
SLC25A41-601HCL | Recombinant Human SLC25A41 lysate | +Inquiry |
MRPL35-4176HCL | Recombinant Human MRPL35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket