Recombinant Full Length Aspergillus Oryzae Mitochondrial Import Inner Membrane Translocase Subunit Tim54(Tim54) Protein, His-Tagged
Cat.No. : | RFL16118AF |
Product Overview : | Recombinant Full Length Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim54(tim54) Protein (Q2UJY4) (1-445aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-445) |
Form : | Lyophilized powder |
AA Sequence : | MPNFRLKLPSRNWMIFLTVTGSFTAALVYDRKQKKRAQQKWCDLVAHLSKESLPVDQTRR KLTVFLSAPPGDGLRVAREHFKEYVKPILVAAALDYQVIEGRREGEIRAGLAERIRKFRR KSGEPSTVVEETGIEEVVADAREKIGVVEEPVPKGDLIIGRNTWKEYIRGLHEGWLGPLD PPQPPLSTDVPSPSEGAETNGSPDDTPTAENSEKKEEPEKKDEKPSKPTGPTPAYITPAD YSSQSLPRSLPQSLDGSVPIQFPHILGFLNTPIRIYRYLNQRYLADSVGREVAGIVLAST TRPYSDGSFSTDSELTPAGIDGAPASDNLLGGNYEQKTLLEEEEKDWHKSAHKKDEANPD KEREWVDSVVLDPRIAARMQRYVLSPEDEARSQRIAEGAEYILGEERPTPVPFWQRMWIK YGYGEDEETLKRKPIIGNIDGEDDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tim54 |
Synonyms | tim54; AO090003001024; Mitochondrial import inner membrane translocase subunit tim54 |
UniProt ID | Q2UJY4 |
◆ Recombinant Proteins | ||
LAMA1-3340H | Recombinant Human LAMA1 protein, His-GST-tagged | +Inquiry |
AKAP12-8983H | Recombinant Human AKAP12 protein, His-tagged | +Inquiry |
NUP58-1589HFL | Recombinant Full Length Human NUP58 Protein, C-Flag-tagged | +Inquiry |
XRCC6-10244M | Recombinant Mouse XRCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNA2-628H | Active Recombinant Human IFNA2 Protein | +Inquiry |
◆ Native Proteins | ||
GPT-1840H | Active Native Human GPT | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUCB1-3659HCL | Recombinant Human NUCB1 293 Cell Lysate | +Inquiry |
NGB-3837HCL | Recombinant Human NGB 293 Cell Lysate | +Inquiry |
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
CCNH-7705HCL | Recombinant Human CCNH 293 Cell Lysate | +Inquiry |
EPHB6-1319CCL | Recombinant Cynomolgus EPHB6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tim54 Products
Required fields are marked with *
My Review for All tim54 Products
Required fields are marked with *
0
Inquiry Basket