Recombinant Full Length Human NUP58 Protein, C-Flag-tagged
Cat.No. : | NUP58-1589HFL |
Product Overview : | Recombinant Full Length Human NUP58 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGS KPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSAL TSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATST AGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAM LKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILV QQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGY RKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGT PFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NUP58 nucleoporin 58 [ Homo sapiens (human) ] |
Official Symbol | NUP58 |
Synonyms | NUP45; NUPL1; PRO2463 |
Gene ID | 9818 |
mRNA Refseq | NM_014089.4 |
Protein Refseq | NP_054808.1 |
MIM | 607615 |
UniProt ID | Q9BVL2 |
◆ Native Proteins | ||
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
◆ Cell & Tissue Lysates | ||
Esophagus-124H | Human Esophagus Membrane Tumor Lysate | +Inquiry |
UBL4A-554HCL | Recombinant Human UBL4A 293 Cell Lysate | +Inquiry |
TAF1C-1733HCL | Recombinant Human TAF1C cell lysate | +Inquiry |
VSIG2-1915HCL | Recombinant Human VSIG2 cell lysate | +Inquiry |
FAM83A-6344HCL | Recombinant Human FAM83A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUP58 Products
Required fields are marked with *
My Review for All NUP58 Products
Required fields are marked with *
0
Inquiry Basket